Euro
British Pound
US Dollar
Product Description
Recombinant Mycobacterium tuberculosis Low molecular weight antigen MTB12 (mtb12) is available at Gentaur for Next week Delivery.
Gene Name: mtb12
Alternative Names : CFP-2 Low molecular weight protein antigen 2
Expression Region : 49-168aa
AA Sequence : DPASAPDVPTAAQLTSLLNSLADPNVSFANKGSLVEGGIGGTEARIADHKLKKAAEHGDLPLSFSVTNIQPAAAGSATADVSVSGPKLSSPVTQNVTFVNQGGWMLSRASAMELLQAAGN
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 14.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May play a role in the development of protective immune responses.
Function : May play a role in the development of protective immune responses.
Involvement in disease :
Subcellular location : Secreted
Protein Families : MTB12 family
Tissue Specificity :
Paythway :
Uniprot ID : P9WIN6
