Recombinant Mycobacterium tuberculosis Malate synthase G (glcB), partial

Product Description

Recombinant Mycobacterium tuberculosis Malate synthase G (glcB), partial is available at Gentaur for Next week Delivery.

Gene Name: glcB

Alternative Names :

Expression Region : 136-263aa

AA Sequence : GSLYDALYGTDVIPETDGAEKGPTYNKVRGDKVIAYARKFLDDSVPLSSGSFGDATGFTVQDGQLVVALPDKSTGLANPGQFAGYTGAAESPTSVLLINHGLHIEILIDPESQVGTTDRAGVKDVILE

Sequence Info : Partial

Tag Info : Tag-Free

Theoretical MW : 13.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in the glycolate utilization. Catalyzes the condensation and subsequent hydrolysis of acetyl-coenzyme A (acetyl-CoA) and glyoxylate to form malate and CoA.

Function : Involved in the glycolate utilization. Catalyzes the condensation and subsequent hydrolysis of acetyl-coenzyme A (acetyl-CoA) and glyoxylate to form malate and CoA.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Malate synthase family, GlcB subfamily

Tissue Specificity :

Paythway :

Uniprot ID : A5U3K4