Recombinant Mycoplasma pneumoniae Chaperone protein DnaK (dnaK), partial

Product Description

Recombinant Mycoplasma pneumoniae Chaperone protein DnaK (dnaK), partial is available at Gentaur for Next week Delivery.

Gene Name: dnaK

Alternative Names : HSP70 Heat shock 70KDA protein Heat shock protein 70

Expression Region : 423-595aa

AA Sequence : QGERPMARDNKSLGRFNLGGIQPAPKGKPQIEITFSLDANGILNVKAKDLTTQKENSITISDNGNLSEEEIQKMIRDAEANKERDNVIRERIELRNEGESIVSTIKEILQSPEAKDFPKEEKEKLDKITGGIDAAIKANDYTKLKAEIENFKKWREEMAKKYNPNGDQGQPAQ

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 35.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Acts as a chaperone.

Function : Acts as a chaperone.

Involvement in disease :

Subcellular location :

Protein Families : Heat shock protein 70 family

Tissue Specificity :

Paythway :

Uniprot ID : P75344