Product Description
Recombinant Mycoplasma pneumoniae Chaperone protein DnaK (dnaK), partial is available at Gentaur for Next week Delivery.
Gene Name: dnaK
Alternative Names : HSP70 Heat shock 70KDA protein Heat shock protein 70
Expression Region : 423-595aa
AA Sequence : QGERPMARDNKSLGRFNLGGIQPAPKGKPQIEITFSLDANGILNVKAKDLTTQKENSITISDNGNLSEEEIQKMIRDAEANKERDNVIRERIELRNEGESIVSTIKEILQSPEAKDFPKEEKEKLDKITGGIDAAIKANDYTKLKAEIENFKKWREEMAKKYNPNGDQGQPAQ
Sequence Info : Partial
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 35.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Acts as a chaperone.
Function : Acts as a chaperone.
Involvement in disease :
Subcellular location :
Protein Families : Heat shock protein 70 family
Tissue Specificity :
Paythway :
Uniprot ID : P75344
Euro
British Pound
US Dollar