Product Description
Recombinant Mycoplasma pneumoniae Lon protease (lon), partial is available at Gentaur for Next week Delivery.
Gene Name: lon
Alternative Names : ATP-dependent protease La
Expression Region : 1-206aa
AA Sequence : MPAVKKPQILVVRNQVIFPYNGFELDVGRERSKKLIKALKNLKTKRLVLVTQKNSDQLNPEFDDIYHCGTLCDIDEIIEVPSEDGKTADYKIKGKGLQRVAITSFSDADLTKYDHHFLNSTLTENKALDKLLERIFPDKEDFAEILDSLNSFLELQELKKLSKVPKDIKRYDIITFKLASLIFKDITLQQAILEENDIEKRLQKII
Sequence Info : Partial
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 39.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cell Biology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : ATP-dependent serine protease that mediates the selective degradation of mutant and abnormal proteins as well as certain short-lived regulatory proteins. Required for cellular homeostasis and for survival from DNA damage and developmental changes induced by stress. Degrades polypeptides processively to yield small peptide fragments that are 5 to 10 amino acids long. Binds to DNA in a double-stranded, site-specific manner.
Function : ATP-dependent serine protease that mediates the selective degradation of mutant and abnormal proteins as well as certain short-lived regulatory proteins. Required for cellular homeostasis and for survival from DNA damage and developmental changes induced by stress. Degrades polypeptides processively to yield small peptide fragments that are 5 to 10 amino acids long. Binds to DNA in a double-stranded, site-specific manner.
Involvement in disease :
Subcellular location : Cytoplasm
Protein Families : Peptidase S16 family
Tissue Specificity :
Paythway :
Uniprot ID : P78025
Euro
British Pound
US Dollar