Product Description
Recombinant Naja atra Cytotoxin 4 is available at Gentaur for Next week Delivery.
Gene Name: N/A
Alternative Names : Cardiotoxin A4 Short name: CTX A4 Cardiotoxin analog IV Short name: CTX IV
Expression Region : 22-81aa
AA Sequence : RKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 22.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Basic protein that bind to cell membrane and depolarizes cardiomyocytes. This cytotoxin also shows lytic activities, but 2-fold more important than that of CTX-A2. It binds to the integrin alpha-V/beta-3 with a moderate affinity. Inhibits protein kinase C. It may interact with sulfatides in the cell membrane, which induces pore formation and cell internalization and is responsible for cytotoxicity in cardiomyocytes. It also may target the mitochondrial membrane and induces mitochondrial swelling and fragmentation.
Function : Basic protein that bind to cell membrane and depolarizes cardiomyocytes. This cytotoxin also shows lytic activities, but 2-fold more important than that of CTX-A2. It binds to the integrin alpha-V/beta-3 with a moderate affinity. Inhibits protein kinase C. It may interact with sulfatides in the cell membrane, which induces pore formation and cell internalization and is responsible for cytotoxicity in cardiomyocytes. It also may target the mitochondrial membrane and induces mitochondrial swelling and fragmentation.
Involvement in disease :
Subcellular location : Secreted, Target cell membrane
Protein Families : Snake three-finger toxin family, Short-chain subfamily, Type IA cytotoxin sub-subfamily
Tissue Specificity : Expressed by the venom gland.
Paythway :
Uniprot ID : P01443
Euro
British Pound
US Dollar