Recombinant Naja mossambica Cytotoxin 5

Product Description

Recombinant Naja mossambica Cytotoxin 5 is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names : CTX M51 CTX V

Expression Region : 1-60aa

AA Sequence : LKCKKLIPLFSKTCPEGKNLCYKMTMRLAPKVPVKRGCIDVCPKSSFLVKYECCDTDRCN

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 10.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Shows cytolytic activity on many different cells by forming pore in lipid membranes. In vivo, increases heart rate or kills the animal by cardiac arrest. In addition, it binds to heparin with high affinity, interacts with Kv channel-interacting protein 1 (KCNIP1) in a calcium-independent manner, and binds to integrin alpha-V/beta-3 (ITGAV/ITGB3) with moderate affinity.

Function : Shows cytolytic activity on many different cells by forming pore in lipid membranes

Involvement in disease :

Subcellular location : Secreted, Target cell membrane

Protein Families : Snake three-finger toxin family, Short-chain subfamily, Type IA cytotoxin sub-subfamily

Tissue Specificity : Expressed by the venom gland.

Paythway :

Uniprot ID : P25517