Recombinant Neosartorya fumigata Ribonuclease mitogillin (mitF)

Product Description

Recombinant Neosartorya fumigata Ribonuclease mitogillin (mitF) is available at Gentaur for Next week Delivery.

Gene Name: mitF

Alternative Names : Allergen Asp f I Allergen I/a IgE-binding ribotoxin Major allergen Asp f 1 Allergen: Asp f 1 aspF1

Expression Region : 28-176aa

AA Sequence : ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged

Theoretical MW : 34.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : This purine-specific ribonuclease cleaves 28S RNA in eukaryotic ribosomes, inhibits protein synthesis, and shows antitumor activity.

Function : This purine-specific ribonuclease cleaves 28S RNA in eukaryotic ribosomes, inhibits protein synthesis, and shows antitumor activity.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Ribonuclease U2 family

Tissue Specificity :

Paythway :

Uniprot ID : P67875