Recombinant Oncorhynchus mykiss Myelin proteolipid protein (plp), partial

Product Description

Recombinant Oncorhynchus mykiss Myelin proteolipid protein (plp), partial is available at Gentaur for Next week Delivery.

Gene Name: plp

Alternative Names : DM20Lipophilin

Expression Region : 150-218aa

AA Sequence : PSSSSLIWHRPATTSTSWTETTPSINQHGWICMDARQYGLLPWNAMPGKACGMTLASICKTKEFFVTYD

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 9.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : This is the major myelin protein from the central nervous syst. It plays an important role in the formation or maintenance of the multilamellar structure of myelin. May be involved in neuron and glial cell differentiation.

Function : This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin. May be involved in neuron and glial cell differentiation.

Involvement in disease :

Subcellular location : Cell membrane, Multi-pass membrane protein

Protein Families : Myelin proteolipid protein family

Tissue Specificity : Central nervous system. Highest levels in spinal cord and medulla oblongata.

Paythway :

Uniprot ID : P79826