Recombinant Parietaria judaica Probable non-specific lipid-transfer protein 2 (LTP2)

Product Description

Recombinant Parietaria judaica Probable non-specific lipid-transfer protein 2 (LTP2) is available at Gentaur for Next week Delivery.

Gene Name: LTP2

Alternative Names : Allergen Par j II Major pollen allergen Par j 2.0101 Protein P2 Allergen: Par j 2.0101

Expression Region : 32-133aa

AA Sequence : EEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSKIQSTIFRGYY

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 27.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

Function : Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

Involvement in disease :

Subcellular location :

Protein Families : Plant LTP family

Tissue Specificity :

Paythway :

Uniprot ID : P55958