Recombinant Pig Antibacterial peptide PMAP-36 (PMAP36)

Product Description

Recombinant Pig Antibacterial peptide PMAP-36 (PMAP36) is available at Gentaur for Next week Delivery.

Gene Name: PMAP36

Alternative Names : Myeloid antibacterial peptide 36

Expression Region : 130-166aa

AA Sequence : VGRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 20.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Exerts antimicrobial activity against both Gram-positive and negative bacteria. Its activity appears to be mediated by its ability to damage bacterial membranes.

Function : Exerts antimicrobial activity against both Gram-positive and negative bacteria. Its activity appears to be mediated by its ability to damage bacterial membranes.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Cathelicidin family

Tissue Specificity :

Paythway :

Uniprot ID : P49931