Recombinant Pig Saposin-B-Val (PSAP)

Product Description

Recombinant Pig Saposin-B-Val (PSAP) is available at Gentaur for Next week Delivery.

Gene Name: PSAP

Alternative Names : Cerebroside sulfate activator (CS-ACT) (Non-specific activator) (Sphingolipid activator protein 1) (SAP-1)

Expression Region : 1-80aa

AA Sequence : GDVCQDCIQMVTDLQNAVRTNSTFVEALVNHAKEECDRLGPGMADMCKNYISQYSEIAIQMMMHMQPKDICGLVGFCEEV

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-Flag-tagged

Theoretical MW : 11.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Saposin-B stimulates the hydrolysis of galacto-cerebroside sulfate by arylsulfatase A (EC 3.1.6.8), GM1 gangliosides by beta-galactosidase (EC 3.2.1.23) and globotriaosylceramide by alpha-galactosidase A (EC 3.2.1.22). Saposin-B forms a solubilizing complex with the substrates of the sphingolipid hydrolases.

Function : Saposin-B stimulates the hydrolysis of galacto-cerebroside sulfate by arylsulfatase A (EC 3.1.6.8), GM1 gangliosides by beta-galactosidase (EC 3.2.1.23) and globotriaosylceramide by alpha-galactosidase A (EC 3.2.1.22). Saposin-B forms a solubilizing complex with the substrates of the sphingolipid hydrolases.

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : P81405