Recombinant Pig Transcobalamin-1 (TCN1)

Product Description

Recombinant Pig Transcobalamin-1 (TCN1) is available at Gentaur for Next week Delivery.

Gene Name: TCN1

Alternative Names : CobalophilinHaptocorrin;Protein RTranscobalamin I;TC I;TCI

Expression Region : 25-416aa

AA Sequence : CVVSEKDYSHLRLLISAMDNLEQIRGIYGASILLSQRLAGIQNPSLEEELSQRIQDDMNRRDMSNLTSGQLALIILAFGACKTPDVRFIHDHHLVEKLGEKFKEEIKNMEIHNSNPLTNYYQLSFDVLTLCLFRGNYSISNVTHYFNPENKNFNLSGHFSVDTGAVAVLALTCVKRSISNGKIKAAIKDSDTIQKYIESLVHKIQSEKMVVSLETRIAQEKLCRLSLSHQTITKMNQIAKKLWTRCLTHSQGVFRLPIAAAQILPALLGKTYLDVTKLLLVPKVQVNITDEPVPVVPTLSPENISVIYCVKINEISNCINITVFLDVMKAAQEKNSTIYGFTMTETPWGPYITSVQGIWANNNERTYWEHSEQQQITKPRSMGIMLSKMESI

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 46.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Binds vitamin B12 with ftomolar affinity and protects it from the acidic environment of the stomach . Binds to cobalamin and to cobalamin analogs such as cobinamide.

Function : Binds vitamin B12 with femtomolar affinity and protects it from the acidic environment of the stomach (By similarity). Binds to cobalamin and to cobalamin analogs such as cobinamide.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Eukaryotic cobalamin transport proteins family

Tissue Specificity : Haptocorrins are a family of cobalamin-binding glycoproteins found in blood, salivary and mucosal secretions.

Paythway :

Uniprot ID : P17630