Recombinant Pig Vasopressin V2 receptor (AVPR2), partial

Product Description

Recombinant Pig Vasopressin V2 receptor (AVPR2), partial is available at Gentaur for Next week Delivery.

Gene Name: AVPR2

Alternative Names : V2R Alternative name(s): AVPR V2 Antidiuretic hormone receptor Renal-type arginine vasopressin receptor

Expression Region : 292-370aa

AA Sequence : WSVWDPKAPREGPPFVLLMLLASLNSCTNPWIYASFSSSISSELRSLLCCPRRRTPPSLRPQEESCATASSFSARDTSS

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 24.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate adenylate cyclase (PubMed:8393786). Involved in renal water reabsorption (By similarity).

Function : Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate adenylate cyclase

Involvement in disease :

Subcellular location : Cell membrane, Multi-pass membrane protein

Protein Families : G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily

Tissue Specificity :

Paythway :

Uniprot ID : P32307