Recombinant Pinctada fucata N16.1 matrix protein

Product Description

Recombinant Pinctada fucata N16.1 matrix protein is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names :

Expression Region : 24-131aa

AA Sequence : AYHKKCGRYSYCWIPYDIERDRRDNGGKKYCFCRYAWSPWQCNEEERYEWLRCGMRFYSLCCYTDDDNGNGNGNGNGNGLNYLKSLYGGYGNGNGEFREEYIDERYDN

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 14.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May be specifically involved in the formation of the nacreous layer.

Function : May be specifically involved in the formation of the nacreous layer.

Involvement in disease :

Subcellular location : Secreted, extracellular space, extracellular matrix

Protein Families : N16 matrix protein family

Tissue Specificity : Component of conchiolin, the organic matrix of nacre. Expressed at extremely high levels in the dorsal region of the mantle, which region may be responsible for the nacreous layer formation, but only in trace amounts at the mantle edge, which region may be responsible for the prismatic layer formation.

Paythway :

Uniprot ID : Q9TVT2