Recombinant Pongo pygmaeus Beta-defensin 126 (DEFB126), partial

Product Description

Recombinant Pongo pygmaeus Beta-defensin 126 (DEFB126), partial is available at Gentaur for Next week Delivery.

Gene Name: DEFB126

Alternative Names : Defensin, beta 126

Expression Region : 21-63aa

AA Sequence : SWYVKKCLNDVGICKKKCKPEELHVKNGWAMCGKQRDCCVPAD

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 31.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Has antibacterial activity.Curated

Function : Highly glycosylated atypical beta-defensin involved in several aspects of sperm function. Facilitates sperm transport in the female reproductive tract and contributes to sperm protection against immunodetection; both functions are probably implicating the negative surface charge provided by its O-linked oligosaccharides in the sperm glycocalyx. Involved in binding of sperm to oviductal epithelial cells to form a sperm reservoir until ovulation. Release from the sperm surface during capacitation and ovaluation by an elevation of oviductal fluid pH is unmasking other surface components and allows sperm to penetrate the cumulus matrix and bind to the zona pellucida of the oocyte. In vitro has antimicrobial activity and may inhibit LPS-mediated inflammation (By similarity).

Involvement in disease :

Subcellular location : Secreted

Protein Families : Beta-defensin family

Tissue Specificity :

Paythway :

Uniprot ID : A4H244