Recombinant Pongo pygmaeus Phospholipid hydroperoxide glutathione peroxidase, mitochondrial (GPX4), partial

Product Description

Recombinant Pongo pygmaeus Phospholipid hydroperoxide glutathione peroxidase, mitochondrial (GPX4), partial is available at Gentaur for Next week Delivery.

Gene Name: GPX4

Alternative Names : Glutathione peroxidase 4 Short name:GPx-4 Short name:GSHPx-4

Expression Region : 1-170aa

AA Sequence : MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLI

Sequence Info : Cytoplasmic Domain

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 35 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Could play a major role in protecting mammals from the toxicity of ingested lipid hydroperoxides. Essential for embryonic development. Protects from radiation and oxidative damage

Function : Protects cells against membrane lipid peroxidation and cell death. Required for normal sperm development and male fertility. Could play a major role in protecting mammals from the toxicity of ingested lipid hydroperoxides. Essential for embryonic development. Protects from radiation and oxidative damage. Essential for maturation and survival of photoreceptor cells. Plays a role in a primary T cell response to viral and parasitic infection by protecting T cells from ferroptosis, a cell death resulting from an iron-dependent accumulation of lipid reactive oxygen species, and by supporting T cell expansion.

Involvement in disease :

Subcellular location : Mitochondrion, Cytoplasm

Protein Families : Glutathione peroxidase family

Tissue Specificity :

Paythway :

Uniprot ID : Q4AEH2