Recombinant Pseudechis porphyriacus Basic phospholipase A2 pseudexin B chain

Product Description

Recombinant Pseudechis porphyriacus Basic phospholipase A2 pseudexin B chain is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names : Phosphatidylcholine 2-acylhydrolase

Expression Region : 1-117aa

AA Sequence : NLIQFSNMIKCAIPGSRPLFQYADYGCYCGPGGHGTPVDELDRCCKIHDDCYGEAGKKGCFPKLTLYSWKCTEKVPTCNAKSRCKDFVCACDAEAAKCFAKAPYIKENYNINTKTRC

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-sumostar-tagged

Theoretical MW : 29 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.

Function : PLA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Phospholipase A2 family, Group I subfamily, D49 sub-subfamily

Tissue Specificity : Expressed by the venom gland.

Paythway :

Uniprot ID : P20259