Recombinant Pseudomonas aeruginosa PA-I galactophilic lectin (lecA)

Product Description

Recombinant Pseudomonas aeruginosa PA-I galactophilic lectin (lecA) is available at Gentaur for Next week Delivery.

Gene Name: lecA

Alternative Names : Galactose-binding lectin

Expression Region : 2-122aa

AA Sequence : AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 16.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : D-galactose specific lectin. Binds in decreasing order of affinity: melibiose, methyl-alpha-D-galactoside, D-galactose, methyl-beta-D-galactoside, N-acetyl-D-galactosamine. Similar to plant lectins in its selective (carbohydrate-specific) hagglutinating activity.

Function : D-galactose specific lectin. Binds in decreasing order of affinity

Involvement in disease :

Subcellular location : Cytoplasm, Periplasm, Cell surface

Protein Families : LecA/PllA lectin family

Tissue Specificity :

Paythway :

Uniprot ID : Q05097