Product Description
Recombinant Pyrococcus furiosus Putative L-asparaginase (PF0142), partial is available at Gentaur for Next week Delivery.
Gene Name: PF0142
Alternative Names : L-asparagine amidohydrolase Cleaved into the following 2 chains: Putative L-asparaginase subunit alpha Putative L-asparaginase subunit beta
Expression Region : 1-175aa
AA Sequence : MVAIIVHGGAGTIRKEERIPKIIEGVREAVLTGWRELKKGSALDAVEEAVKVLEDNPLFNAGTGSVLTLDGKVEMDAAIMRGKTLDAGAVAGIWGVKNPISVARKVMEKTDHVLLIGEGAVKFARLMGFPEYDPTTEERRKQWEELRKKLLETGEIRHWKKLSELIKEYPEVLRS
Sequence Info : Partial
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 35.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : L-asparagine + H2O = L-aspartate + NH3.
Function :
Involvement in disease :
Subcellular location :
Protein Families : Ntn-hydrolase family
Tissue Specificity :
Paythway :
Uniprot ID : Q8U4E6