Recombinant Rabbit Integrin beta-8 (ITGB8), partial

Product Description

Recombinant Rabbit Integrin beta-8 (ITGB8), partial is available at Gentaur for Next week Delivery.

Gene Name: ITGB8

Alternative Names :

Expression Region : 146-384aa

AA Sequence : PVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFERAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLRNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKL

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 30.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Integrin alpha-V/beta-8 is a receptor for fibronectin.

Function : Integrin alpha-V/beta-8 is a receptor for fibronectin.

Involvement in disease :

Subcellular location : Membrane, Single-pass type I membrane protein

Protein Families : Integrin beta chain family

Tissue Specificity : Placenta, kidney, brain, ovary, uterus and in several transformed cells.

Paythway :

Uniprot ID : P26013