Recombinant Rabbit Tumor necrosis factor (TNF), partial (Active)

Product Description

Recombinant Rabbit Tumor necrosis factor (TNF), partial (Active) is available at Gentaur for Next week Delivery.

Gene Name: TNF

Alternative Names : Tumor Necrosis Factor; Cachectin; TNF-Alpha; Tumor Necrosis Factor Ligand Superfamily Member 2; TNF-a; TNF; TNFA; TNFSF2

Expression Region : 77-235aa

AA Sequence : MVTLRSASRALSDKPLAHVVANPQVEGQLQWLSQRANALLANGMKLTDNQLVVPADGLYLIYSQVLFSGQGCRSYVLLTHTVSRFAVSYPNKVNLLSAIKSPCHRETPEEAEPMAWYEPIYLGGVFQLEKGDRLSTEVNQPEYLDLAESGQVYFGIIAL

Sequence Info : Partial

Tag Info : Tag-Free

Theoretical MW : 17.59 kDa

Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 300 mM NaCl, pH 7.4

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined in a cytotoxicity assay using L?929 mouse fibroblast cells is less than 20 pg/ml in the presence of the metabolic inhibitor actinomycin D.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Tumor necrosis factor alpha (TNF?) is the prototypic ligand of the TNF superfamily. TNF? forms a homotrimer and functions by activating two types of receptors TNF-R1 (TNF receptor type 1,p55R) and TNF-R2 (TNF receptor type 2,p75R). TNF? is a pleiotropic cytokine that is capable to promote inflammation, to induce apoptotic cell death, and to inhibit tumorigenesis and viral replication. TNF? is a potent lymphoid factor that exerts cytotoxic effects on a wide range of tumor cells and certain other target cells.

Function : Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.; FUNCTION

Involvement in disease :

Subcellular location : Cell membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Tumor necrosis factor, membrane form: Membrane, Single-pass type II membrane protein, SUBCELLULAR LOCATION: Tumor necrosis factor, soluble form: Secreted, SUBCELLULAR LOCATION: C-domain 1: Secreted, SUBCELLULAR LOCATION: C-domain 2: Secreted

Protein Families : Tumor necrosis factor family

Tissue Specificity :

Paythway :

Uniprot ID : P04924