Recombinant Raphanus sativus Defensin-like protein 2 (AFP2)

Product Description

Recombinant Raphanus sativus Defensin-like protein 2 (AFP2) is available at Gentaur for Next week Delivery.

Gene Name: AFP2

Alternative Names : Cysteine-rich antifungal protein 2 Short name: AFP2 Short name: RAFP2

Expression Region : 30-80aa

AA Sequence : QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 21.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Possesses antifungal activity sensitive to inorganic cations. Induces potential changes in fungal membranes and increased K+ efflux and Ca2+ uptake.

Function : Possesses antifungal activity sensitive to inorganic cations. Induces potential changes in fungal membranes and increased K(+) efflux and Ca(2+) uptake.

Involvement in disease :

Subcellular location : Secreted

Protein Families : DEFL family

Tissue Specificity :

Paythway :

Uniprot ID : P30230