Product Description
Recombinant Rat Acyl-CoA-binding protein (Dbi) is available at Gentaur for Next week Delivery.
Gene Name: Dbi
Alternative Names : Diazepam-binding inhibitor
Expression Region : 2-87aa
AA Sequence : SQADFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKENAMKTYVEKVEELKKKYGI
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW : 16.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Transport
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.
Function : Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.
Involvement in disease :
Subcellular location : Endoplasmic reticulum, Golgi apparatus
Protein Families : ACBP family
Tissue Specificity :
Paythway :
Uniprot ID : P11030
Euro
British Pound
US Dollar