Recombinant Rat Alpha-synuclein (Snca)

Product Description

Recombinant Rat Alpha-synuclein (Snca) is available at Gentaur for Next week Delivery.

Gene Name: Snca

Alternative Names :

Expression Region : 1-140aa

AA Sequence : MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDPSSEAYEMPSEEGYQDYEPEA

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 41.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May be involved in the regulation of dopamine release and transport.

Function : May be involved in the regulation of dopamine release and transport.

Involvement in disease :

Subcellular location : Cytoplasm, cytosol, Membrane, Nucleus, Cell junction, synapse, Secreted

Protein Families : Synuclein family

Tissue Specificity : Found only in brain (hippocampus, brainstem and cortex). Specifically expressed in neuronal cell bodies and synapses.

Paythway :

Uniprot ID : P37377