Product Description
Recombinant Rat Amphoterin-induced protein 3 (Amigo3) is available at Gentaur for Next week Delivery.
Gene Name: Amigo3
Alternative Names : AMIGO-3 Alivin-3
Expression Region : 20-383aa
AA Sequence : TSDLEGVLPPDPHNCPNKCVCAADVLSCAGRGLQDLPAALPATAAELDLSHNALKRLHPGWLAPLSRLRALYLGYNKLDVLGRGVFTNASGLRILDLSSNLLRRLRTYDLDGLEELEKLLLFNNRLMHLDLDAFQGLSMLSHLYLSCNELSSFSFNHLHGLGLTRLRTLDLSSNWLGHVSVPELAALPTFLKNRLYLHNNPLPCDCSLYHLLRRWHQRGLSALHDFEREYTCLAFKVAESRVRFFEHSRVFKNCSVAAAPGLELPEEELHTHVGQSLRLFCNTTVPAARVAWVSPKNELLVAPGSQDGSIAVLADGSLAIGRVQEQHAGLFVCLASGPRLHHNQTLEYNVSVHKPRPEPEAFNT
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 44.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cell Biology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May mediate heterophilic cell-cell interaction. May contribute to signal transduction through its intracellular domain.
Function : May mediate heterophilic cell-cell interaction. May contribute to signal transduction through its intracellular domain.
Involvement in disease :
Subcellular location : Membrane, Single-pass type I membrane protein
Protein Families : Immunoglobulin superfamily, AMIGO family
Tissue Specificity :
Paythway :
Uniprot ID : Q80ZD5
Euro
British Pound
US Dollar