Recombinant Rat Amphoterin-induced protein 3 (Amigo3)

Product Description

Recombinant Rat Amphoterin-induced protein 3 (Amigo3) is available at Gentaur for Next week Delivery.

Gene Name: Amigo3

Alternative Names : AMIGO-3 Alivin-3

Expression Region : 20-383aa

AA Sequence : TSDLEGVLPPDPHNCPNKCVCAADVLSCAGRGLQDLPAALPATAAELDLSHNALKRLHPGWLAPLSRLRALYLGYNKLDVLGRGVFTNASGLRILDLSSNLLRRLRTYDLDGLEELEKLLLFNNRLMHLDLDAFQGLSMLSHLYLSCNELSSFSFNHLHGLGLTRLRTLDLSSNWLGHVSVPELAALPTFLKNRLYLHNNPLPCDCSLYHLLRRWHQRGLSALHDFEREYTCLAFKVAESRVRFFEHSRVFKNCSVAAAPGLELPEEELHTHVGQSLRLFCNTTVPAARVAWVSPKNELLVAPGSQDGSIAVLADGSLAIGRVQEQHAGLFVCLASGPRLHHNQTLEYNVSVHKPRPEPEAFNT

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 44.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May mediate heterophilic cell-cell interaction. May contribute to signal transduction through its intracellular domain.

Function : May mediate heterophilic cell-cell interaction. May contribute to signal transduction through its intracellular domain.

Involvement in disease :

Subcellular location : Membrane, Single-pass type I membrane protein

Protein Families : Immunoglobulin superfamily, AMIGO family

Tissue Specificity :

Paythway :

Uniprot ID : Q80ZD5