Recombinant Rat Apolipoprotein A-V (Apoa5)

Product Description

Recombinant Rat Apolipoprotein A-V (Apoa5) is available at Gentaur for Next week Delivery.

Gene Name: Apoa5

Alternative Names : Apolipoprotein A5;Regeneration-associated protein 3

Expression Region : 21-367aa

AA Sequence : RKSFWEYFGQNSQGKGMMGQQQKLAQESLKGSLEQDLYNMNNFLEKLGPLREPGKEPPRLAQDPEGIRKQLQQELEEVSTRLEPYMAAKHQQVGWNLEGLRQQLKPYTVELMEQVGLSVQDLQEQLRMVGKGTKAQLLGGVDEAMSLLQDMQSRVLHHTDRVKELFHPYAERLVTGIGHHVQELHRSVAPHAVASPARLSRCVQTLSHKLTRKAKDLHTSIQRNLDQLRDELSTFIRVSTDGADNRDSLDPQALSDEVRQRLQAFRHDTYLQIAAFTQAIDQETEEIQHQLAPPPPSHSAFAPELGHSDSNKALSRLQSRLDDLWEDIAYGLHDQGHSQNNPEGHSG

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal GST-tagged

Theoretical MW : 66.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Minor apolipoprotein mainly associated with HDL and to a lesser extent with VLDL. May also be associated with chylomicrons. Important determinant of plasma triglyceride (TG) levels by both being a potent stimulator of apo-CII lipoprotein lipase (LPL) TG hydrolysis and a inhibitor of the hepatic VLDL-TG production rate (without affecting the VLDL-apoB production rate). Activates poorly lecithin:cholesterol acyltransferase (LCAT) and does not enhance efflux of cholesterol from macrophages .

Function : Minor apolipoprotein mainly associated with HDL and to a lesser extent with VLDL. May also be associated with chylomicrons. Important determinant of plasma triglyceride (TG) levels by both being a potent stimulator of apo-CII lipoprotein lipase (LPL) TG hydrolysis and a inhibitor of the hepatic VLDL-TG production rate (without affecting the VLDL-apoB production rate). Activates poorly lecithin

Involvement in disease :

Subcellular location : Secreted

Protein Families : Apolipoprotein A1/A4/E family

Tissue Specificity : Liver.

Paythway :

Uniprot ID : Q9QUH3