Recombinant Rat Artemin (Artn)

Product Description

Recombinant Rat Artemin (Artn) is available at Gentaur for Next week Delivery.

Gene Name: Artn

Alternative Names :

Expression Region : 112-224aa

AA Sequence : AGTRSSRARATDARGCRLRSQLVPVSALGLGHSSDELIRFRFCSGSCRRARSPHDLSLASLLDAGALRSPPGSRPISQPCCRPTRYEAVSFMDVNSTWRTVDHLSATACGCLG

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 17.1kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Ligand for the GFR-alpha-3-RET receptor complex but can also activate the GFR-alpha-1-RET receptor complex. Supports the survival of sensory and sympathetic peripheral neurons in culture and also supports the survival of dopaminergic neurons of the ventral mid-brain. Strong attractant of gut hematopoietic cells thus promoting the formation Peyer's patch-like structures, a major component of the gut-associated lymphoid tissue

Function : Ligand for the GFR-alpha-3-RET receptor complex but can also activate the GFR-alpha-1-RET receptor complex. Supports the survival of sensory and sympathetic peripheral neurons in culture and also supports the survival of dopaminergic neurons of the ventral mid-brain. Strong attractant of gut hematopoietic cells thus promoting the formation Peyer's patch-like structures, a major component of the gut-associated lymphoid tissue (By similarity).

Involvement in disease :

Subcellular location : Secreted

Protein Families : TGF-beta family, GDNF subfamily

Tissue Specificity : Cochlea. Expressed at higher level in sesorineural epithelium than in the modiolus region or substantia nigra.

Paythway :

Uniprot ID : Q6AYE8