Recombinant Rat Brain-derived neurotrophic factor (Bdnf), partial

Product Description

Recombinant Rat Brain-derived neurotrophic factor (Bdnf), partial is available at Gentaur for Next week Delivery.

Gene Name: Bdnf

Alternative Names :

Expression Region : 136-243aa

AA Sequence : RRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTL

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 16.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systs. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS .

Function : During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS (By similarity).

Involvement in disease :

Subcellular location : Secreted

Protein Families : NGF-beta family

Tissue Specificity :

Paythway :

Uniprot ID : P23363