Recombinant Rat Carbonic anhydrase 1 (Ca1)

Product Description

Recombinant Rat Carbonic anhydrase 1 (Ca1) is available at Gentaur for Next week Delivery.

Gene Name: Ca1

Alternative Names : Carbonate dehydratase I

Expression Region : 2-261aa

AA Sequence : ASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 30.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Reversible hydration of carbon dioxide

Function : Reversible hydration of carbon dioxide.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Alpha-carbonic anhydrase family

Tissue Specificity :

Paythway :

Uniprot ID : B0BNN3