Recombinant Rat Collagen alpha-1 (I) chain, partial

Product Description

Recombinant Rat Collagen alpha-1 (I) chain, partial is available at Gentaur for Next week Delivery.

Gene Name: Col1a1

Alternative Names : Alpha-1 type I collagen

Expression Region : 955-1207aa

AA Sequence : QRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGSPGAEGSPGRDGAPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKNGDRGETGPAGPAGPIGPAGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGSPGSPGEQGPSGASGPAGPRGPPGSAGSPGKDGLNGLPGPIGPPGPRGRTGDSGPAGPPGPPGPPGPPGPPSGGYDFSFLPQPPQEKSQDGGRYYRA

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 25.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Type I collagen is a mber of group I collagen (fibrillar forming collagen).

Function : Type I collagen is a member of group I collagen (fibrillar forming collagen).

Involvement in disease :

Subcellular location : Secreted, extracellular space, extracellular matrix

Protein Families : Fibrillar collagen family

Tissue Specificity : Forms the fibrils of tendon, ligaments and bones. In bones the fibrils are mineralized with calcium hydroxyapatite.

Paythway :

Uniprot ID : P02454