Recombinant Rat Fibroblast growth factor 23 (Fgf23)

Product Description

Recombinant Rat Fibroblast growth factor 23 (Fgf23) is available at Gentaur for Next week Delivery.

Gene Name: Fgf23

Alternative Names :

Expression Region : 25-251aa

AA Sequence : YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 27.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Regulator of phosphate homeostasis . Inhibits renal tubular phosphate transport by reducing SLC34A1 levels . Regulator of vitamin-D metabolism . Negatively regulates osteoblasts differentiation and matrix mineralization . Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL.

Function : Regulator of phosphate homeostasis (By similarity). Inhibits renal tubular phosphate transport by reducing SLC34A1 levels (By similarity). Regulator of vitamin-D metabolism (By similarity). Negatively regulates osteoblasts differentiation and matrix mineralization (By similarity). Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Heparin-binding growth factors family

Tissue Specificity : Expressed in the parathyroid.

Paythway :

Uniprot ID : Q8VI82