Product Description
Recombinant Rat Gamma-crystallin B (Crygb) is available at Gentaur for Next week Delivery.
Gene Name: Crygb
Alternative Names : Gamma-B-crystallin Gamma-crystallin 1-2
Expression Region : 2-175aa
AA Sequence : GKITFFEDRGFQGRCYECSSDCPNLQTYFSRCNSVRVDSGCWMLYERPNYQGHQYFLRRGDYPDYQQWMGFSDSIRSCRLIPQHSGTYRMRIYERDDFRGQMSEITDDCLSLQDRFHLSEIHSLNVMEGCWVLYEMPSYRGRQYLLRPGEYRRYLDWGAANAKVGSFRRVMDFY
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 23 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Neuroscience
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Crystallins are the dominant structural components of the vertebrate eye lens.
Function : Crystallins are the dominant structural components of the vertebrate eye lens.
Involvement in disease :
Subcellular location :
Protein Families : Beta/gamma-crystallin family
Tissue Specificity :
Paythway :
Uniprot ID : P10066