Recombinant Rat Glutathione S-transferase alpha-1 (Gsta1)

Product Description

Recombinant Rat Glutathione S-transferase alpha-1 (Gsta1) is available at Gentaur for Next week Delivery.

Gene Name: Gsta1

Alternative Names : GST 1-1;GST 1a-1a;GST A1-1;GST B;Glutathione S-transferase Ya-1;GST Ya1;Ligandin

Expression Region : 2-222aa

AA Sequence : SGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 41.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.

Function : Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : GST superfamily, Alpha family

Tissue Specificity :

Paythway :

Uniprot ID : P00502