Product Description
Recombinant Rat Glutathione S-transferase alpha-1 (Gsta1) is available at Gentaur for Next week Delivery.
Gene Name: Gsta1
Alternative Names : GST 1-1;GST 1a-1a;GST A1-1;GST B;Glutathione S-transferase Ya-1;GST Ya1;Ligandin
Expression Region : 2-222aa
AA Sequence : SGKPVLHYFNARGRMECIRWLLAAAGVEFDEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYTEGILDLTEMIMQLVICPPDQKEAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLELLLYVEEFDASLLTSFPLLKAFKSRISSLPNVKKFLQPGSQRKLPVDAKQIEEARKIFKF
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 41.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
Function : Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
Involvement in disease :
Subcellular location : Cytoplasm
Protein Families : GST superfamily, Alpha family
Tissue Specificity :
Paythway :
Uniprot ID : P00502
Euro
British Pound
US Dollar