Recombinant Rat Insulin-1 (Ins1), partial

Product Description

Recombinant Rat Insulin-1 (Ins1), partial is available at Gentaur for Next week Delivery.

Gene Name: Ins1

Alternative Names : Ins-1

Expression Region : 25-54aa

AA Sequence : FVKQHLCGPHLVEALYLVCGERGFFYTPKS

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 19.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.

Function : Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Insulin family

Tissue Specificity :

Paythway :

Uniprot ID : P01322