Product Description
Recombinant Rat Insulin-1 (Ins1), partial is available at Gentaur for Next week Delivery.
Gene Name: Ins1
Alternative Names : Ins-1
Expression Region : 25-54aa
AA Sequence : FVKQHLCGPHLVEALYLVCGERGFFYTPKS
Sequence Info : Partial
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 19.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Function : Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Insulin family
Tissue Specificity :
Paythway :
Uniprot ID : P01322
Euro
British Pound
US Dollar