Recombinant Rat Interleukin-18 (Il18)

Product Description

Recombinant Rat Interleukin-18 (Il18) is available at Gentaur for Next week Delivery.

Gene Name: Il18

Alternative Names : Interferon gamma-inducing factor;IFN-gamma-inducing factorInterleukin-1 gamma;IL-1 gamma

Expression Region : 37-194aa

AA Sequence : HFGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 22.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.

Function : Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.

Involvement in disease :

Subcellular location : Secreted

Protein Families : IL-1 family

Tissue Specificity :

Paythway :

Uniprot ID : P97636