Recombinant Rat Mast cell protease 1 (Mcpt1)

Product Description

Recombinant Rat Mast cell protease 1 (Mcpt1) is available at Gentaur for Next week Delivery.

Gene Name: Mcpt1

Alternative Names : Chymase (Chymotrypsin-like protease) (CLIP protein) (Mast cell protease I) (rMCP-I) (rMCP-1)

Expression Region : 21-260aa

AA Sequence : IIGGVESRPHSRPYMAHLEITTERGYKATCGGFLVTRQFVMTAAHCKGRETTVTLGVHDVSKTESTQQKIKVEKQIVHPNYNFYSNLHDIMLLKLQKKAKVTPAVDVIPLPQPSDFLKPGKMCRAAGWGQTGVTKPTSNTLREVKQRIMDKEACKNYFHYNYNFQVCVGSPRKIRSAYKGDSGGPLVCAGVAHGIVSYGRGDAKPPAVFTRISPYVPWINKVIKGKDLTSLSLHESESPS

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal Myc-tagged

Theoretical MW : 28.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion. May participate in generating perivascular beta-protein which ultimately aggregates into amyloid-beta deposits.

Function : Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion. May participate in generating perivascular beta-protein which ultimately aggregates into amyloid-beta deposits.

Involvement in disease :

Subcellular location : Secreted, Cytoplasmic granule

Protein Families : Peptidase S1 family, Granzyme subfamily

Tissue Specificity :

Paythway :

Uniprot ID : P09650