Product Description
Recombinant Rat Matrilysin (Mmp7) is available at Gentaur for Next week Delivery.
Gene Name: Mmp7
Alternative Names : Matrin;Matrix metalloproteinase-7;MMP-7Pump-1 proteaseUterine metalloproteinase
Expression Region : 98-267aa
AA Sequence : FSLMPNSPKWHSRTVTYRIVSYTTDLPRFLVDQIVKRALRMWSMQIPLNFKRVSWGTADIIIGFARGDHGDNFPFDGPGNTLGHAFAPGPGLGGDAHFDKDEYWTDGEDSGVNFLFVATHELGHSLGLGHSSVPSSVMYPTYQGDHSEDFSLTKDDIAGIQKLYGKRNKL
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 20.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase .
Function : Degrades casein, gelatins of types I, III, IV, and V, and fibronectin. Activates procollagenase (By similarity).
Involvement in disease :
Subcellular location : Secreted, extracellular space, extracellular matrix
Protein Families : Peptidase M10A family
Tissue Specificity :
Paythway :
Uniprot ID : P50280
Euro
British Pound
US Dollar