Recombinant Rat Mucosal addressin cell adhesion molecule 1 (Madcam1), partial

Product Description

Recombinant Rat Mucosal addressin cell adhesion molecule 1 (Madcam1), partial is available at Gentaur for Next week Delivery.

Gene Name: Madcam1

Alternative Names : Short name: MAdCAM-1 Short name: rMAdCAM-1

Expression Region : 20-353aa

AA Sequence : QSFQVNPPEPEVAVAMGTSLQINCSMSCDKDIARVHWHGLDTNLGNVQTLPGSRVLSVRGMLSDTGTRVCVGSCGSRSFQHSVKILVYAFPDQLEVTPEFLVPGRDQVVSCTAHNIWPAGPDSLSFALLRGEQSLEGAQALETEQEEEMQETEGTPLFQVTQRWLLPSLGTPALPALYCQVTMQLPKLVLTHRRKIPVLQSQTSPEPPSTTSAKPYILTSSHTTKAVSTGLSSVALPSTPLSSEGPCYPEIHQNPEADWELLCEASCGSGVTVHWTLAPGDLAAYHKREAGAQAWLSVLPLGPIPEGWFQCRMDPGGQVTSLYVTGQVIPNPSS

Sequence Info : Extracellular Domain

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 52 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both the integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes

Function : Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both the integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes (By similarity).

Involvement in disease :

Subcellular location : Membrane, Single-pass type I membrane protein

Protein Families :

Tissue Specificity : Detected in Peyer patches and mesenteric lymph nodes but not in spleen.

Paythway :

Uniprot ID : O70540