Product Description
Recombinant Rat Nitric oxide synthase, endothelial (Nos3), partial is available at Gentaur for Next week Delivery.
Gene Name: Nos3
Alternative Names : Constitutive NOS;cNOSEC-NOSEndothelial NOS;eNOSNOS type III;NOSIII
Expression Region : 519-690aa
AA Sequence : ATILYGSETGRAQSYAQQLGRLFRKAFDPRVLCMDEYDVVSLEHEALVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSPRPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFCAFARAVDTRLEELGGERLLQLGQGDELCGQ
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 22.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Produces nitric oxide (NO) which is implicated in vascular smooth muscle relaxation through a cGMP-mediated signal transduction pathway. NO mediates vascular endothelial growth factor (VEGF)-induced angiogenesis in coronary vessels and promotes blood clotting through the activation of platelets.
Function : Produces nitric oxide (NO) which is implicated in vascular smooth muscle relaxation through a cGMP-mediated signal transduction pathway. NO mediates vascular endothelial growth factor (VEGF)-induced angiogenesis in coronary vessels and promotes blood clotting through the activation of platelets.
Involvement in disease :
Subcellular location : Membrane, caveola, Cytoplasm, cytoskeleton, Golgi apparatus, Cell membrane
Protein Families : NOS family
Tissue Specificity : Expressed constitutively by vascular endothelium. Detected in alveolar and serosal epithelial cells as well as in endothelial cells in one day old rat. In adult lung, detected in rare endothelial cells.
Paythway :
Uniprot ID : Q62600
 Euro
            
 British Pound
            
 US Dollar