Recombinant Rat Osteocrin (Ostn), partial

Product Description

Recombinant Rat Osteocrin (Ostn), partial is available at Gentaur for Next week Delivery.

Gene Name: Ostn

Alternative Names : Musclin

Expression Region : 82-131aa

AA Sequence : SFSGFGSPLDRLSAGSVEHRGKQRRVVDHSKKRFGIPMDRIGRNRLSSSR

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 21.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Appears to modulate osteoblastic differentiation. Could also function as an autocrine and paracrine factor linked to glucose metabolism in skeletal muscle

Function : Hormone that acts as a ligand for natriuretic peptide receptor NPR3/NPR-C and promotes bone growth and physical endurance in muscle. Acts as a regulator of osteoblast differentiation and bone growth by binding to natriuretic peptide receptor NPR3/NPR-C, thereby preventing binding between NPR3/NPR-C and natriuretic peptides, leading to increase cGMP production. Required to enhance physical endurance

Involvement in disease :

Subcellular location : Secreted

Protein Families : Osteocrin family

Tissue Specificity : Highly expressed in skeletal muscle (PubMed:15044443). Also expressed in leg tendons/ligaments and osteoblasts (PubMed:17951249). In long bones and teeth, present in knee joint and periodontal ligaments (at protein level) (PubMed:17951249).

Paythway :

Uniprot ID : P61365