Product Description
Recombinant Rat Phospholipase A2, membrane associated (Pla2g2a) is available at Gentaur for Next week Delivery.
Gene Name: Pla2g2a
Alternative Names : GIIC sPLA2Group IIA phospholipase A2;Phosphatidylcholine 2-acylhydrolase 2A
Expression Region : 22-146aa
AA Sequence : SLLEFGQMILFKTGKRADVSYGFYGCHCGVGGRGSPKDATDWCCVTHDCCYNRLEKRGCGTKFLTYKFSYRGGQISCSTNQDSCRKQLCQCDKAAAECFARNKKSYSLKYQFYPNKFCKGKTPSC
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 16.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Thought to participate in the regulation of the phospholipid metabolism in biombranes including eicosanoid biosynthesis. Catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.
Function : Catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides
Involvement in disease :
Subcellular location : Cell membrane, Peripheral membrane protein, Secreted
Protein Families : Phospholipase A2 family
Tissue Specificity :
Paythway :
Uniprot ID : P14423
Euro
British Pound
US Dollar