Recombinant Rat Phospholipase A2, membrane associated (Pla2g2a)

Product Description

Recombinant Rat Phospholipase A2, membrane associated (Pla2g2a) is available at Gentaur for Next week Delivery.

Gene Name: Pla2g2a

Alternative Names : GIIC sPLA2Group IIA phospholipase A2;Phosphatidylcholine 2-acylhydrolase 2A

Expression Region : 22-146aa

AA Sequence : SLLEFGQMILFKTGKRADVSYGFYGCHCGVGGRGSPKDATDWCCVTHDCCYNRLEKRGCGTKFLTYKFSYRGGQISCSTNQDSCRKQLCQCDKAAAECFARNKKSYSLKYQFYPNKFCKGKTPSC

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 16.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Thought to participate in the regulation of the phospholipid metabolism in biombranes including eicosanoid biosynthesis. Catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.

Function : Catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides

Involvement in disease :

Subcellular location : Cell membrane, Peripheral membrane protein, Secreted

Protein Families : Phospholipase A2 family

Tissue Specificity :

Paythway :

Uniprot ID : P14423