Product Description
Recombinant Rat Potassium voltage-gated channel subfamily E member 2 (Kcne2) is available at Gentaur for Next week Delivery.
Gene Name: Kcne2
Alternative Names : MinK-related peptide 1Minimum potassium ion channel-related peptide 1;Potassium channel subunit beta MiRP1
Expression Region : 1-123aa
AA Sequence : MTTLANLTQTLEDAFKKVFITYMDSWRRNTTAEQQALQARVDAENFYYVILYLMVMIGMFAFIVVAILVSTVKSKRREHSQDPYHQYIVEDWQQKYRSQILHLEDSKATIHENLGATGFTVSP
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 18.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Ancillary protein that assbles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Associated with KCNH2/HERG is proposed to form the rapidly activating component of the delayed rectifying potassium current in heart (IKr). May associate with KCNQ2 and/or KCNQ3 and modulate the native M-type current. May associate with KCNQ1/KCLQT1 and elicit a voltage-independent current .
Function : Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNB1 modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1
Involvement in disease :
Subcellular location : Cell membrane, Single-pass type I membrane protein
Protein Families : Potassium channel KCNE family
Tissue Specificity : Expressed in the heart (PubMed:19219384).
Paythway :
Uniprot ID : P63161