Product Description
Recombinant Rat Protein-lysine 6-oxidase (Lox) is available at Gentaur for Next week Delivery.
Gene Name: Lox
Alternative Names : Lysyl oxidase
Expression Region : 163-411aa
AA Sequence : DDPYNPYKYSDDNPYYNYYDTYERPRSGSRHRPGYGTGYFQYGLPDLVPDPYYIQASTYVQKMSMYNLRCAAEENCLASSAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDEFSHYDLLDASTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYAADIDCQWIDITDVQPGNYILKVSVNPSYLVPESDYSNNVVRCEIRYTGHHAYASGCTISPY
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 33 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin.
Function : Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin
Involvement in disease :
Subcellular location : Secreted, Secreted, extracellular space
Protein Families : Lysyl oxidase family
Tissue Specificity : Aorta and lung.
Paythway :
Uniprot ID : P16636
Euro
British Pound
US Dollar