Product Description
Recombinant Rat Protein S100-A4 (S100a4) is available at Gentaur for Next week Delivery.
Gene Name: S100a4
Alternative Names : Metastasin (Nerve growth factor-induced protein 42A) (P9K) (Placental calcium-binding protein) (S100 calcium-binding protein A4)
Expression Region : 2-101aa
AA Sequence : ARPLEEALDVIVSTFHKYSGNEGDKFKLNKTELKELLTRELPSFLGRRTDEAAFQKLMNNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW : 18.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cardiovascular
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location :
Protein Families : S-100 family
Tissue Specificity :
Paythway :
Uniprot ID : P05942
Euro
British Pound
US Dollar