Product Description
Recombinant Rat Regenerating islet-derived protein 3-beta (Reg3b) is available at Gentaur for Next week Delivery.
Gene Name: Reg3b
Alternative Names : Pancreatitis-associated protein 1;Peptide 23REG-2Regenerating islet-derived protein III-beta;Reg III-beta
Expression Region : 27-175aa
AA Sequence : EDSPKKIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPEGHLVSVLNVAEASFLASMVKNTGNSYQYTWIGLHDPTLGGEPNGGGWEWSNNDIMNYVNWERNPSTALDRGFCGSLSRSSGFLRWRDTTCEVKLPYVCKFTG
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-sumostar-tagged
Theoretical MW : 32.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Bactericidal C-type lectin which acts against several intestinal Gram-positive bacteria and Gram-negative bacteria. Lacks antibacterial activity against S.typhimurium. May play a role in protection against infection with S.enteritidis by inhibiting its translocation from the gut lumen into intestinal tissues and further extraintestinal tissues .
Function : Bactericidal C-type lectin which acts against several intestinal Gram-positive bacteria and Gram-negative bacteria. Lacks antibacterial activity against S.typhimurium. May play a role in protection against infection with S.enteritidis by inhibiting its translocation from the gut lumen into intestinal tissues and further extraintestinal tissues (By similarity).
Involvement in disease : Overexpressed during the acute phase of pancreatitis.
Subcellular location : Secreted
Protein Families :
Tissue Specificity : Constitutively expressed in intestine.
Paythway :
Uniprot ID : P25031
Euro
British Pound
US Dollar