Recombinant Rat Regenerating islet-derived protein 3-beta (Reg3b)

Product Description

Recombinant Rat Regenerating islet-derived protein 3-beta (Reg3b) is available at Gentaur for Next week Delivery.

Gene Name: Reg3b

Alternative Names : Pancreatitis-associated protein 1;Peptide 23REG-2Regenerating islet-derived protein III-beta;Reg III-beta

Expression Region : 27-175aa

AA Sequence : EDSPKKIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPEGHLVSVLNVAEASFLASMVKNTGNSYQYTWIGLHDPTLGGEPNGGGWEWSNNDIMNYVNWERNPSTALDRGFCGSLSRSSGFLRWRDTTCEVKLPYVCKFTG

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-sumostar-tagged

Theoretical MW : 32.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Bactericidal C-type lectin which acts against several intestinal Gram-positive bacteria and Gram-negative bacteria. Lacks antibacterial activity against S.typhimurium. May play a role in protection against infection with S.enteritidis by inhibiting its translocation from the gut lumen into intestinal tissues and further extraintestinal tissues .

Function : Bactericidal C-type lectin which acts against several intestinal Gram-positive bacteria and Gram-negative bacteria. Lacks antibacterial activity against S.typhimurium. May play a role in protection against infection with S.enteritidis by inhibiting its translocation from the gut lumen into intestinal tissues and further extraintestinal tissues (By similarity).

Involvement in disease : Overexpressed during the acute phase of pancreatitis.

Subcellular location : Secreted

Protein Families :

Tissue Specificity : Constitutively expressed in intestine.

Paythway :

Uniprot ID : P25031