Recombinant Rat Thyroglobulin (Tg), partial

Product Description

Recombinant Rat Thyroglobulin (Tg), partial is available at Gentaur for Next week Delivery.

Gene Name: Tg

Alternative Names : Tg

Expression Region : 21-300aa

AA Sequence : NIFEYQVDAQPLRPCELQREKAFLKQDEYVPQCSEDGSFQTVQCQNDGQSCWCVDSDGTEVPGSRQLGRPTACLSFCQLHKQRILLSSYINSTDALYLPQCQDSGNYAPVQCDLQQVQCWCVDTEGMEVYGTRQQGRPTRCPRSCEIRSRRLLHGVGDKSPPQCDADGEFMPVQCKFVNTTDMMIFDLIHNYNRFPDAFVTFSAFRNRFPEVSGYCYCADSQGRELAETGLELLLDEIYDTIFAGLDQASTFTQSTMYRILQRRFLAIQLVISGRFRCPT

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 48 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Precursor of the iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3).

Function : Precursor of the iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3).

Involvement in disease : Defects in Tg are a cause of a form of hypothyroidism in rdw rat.

Subcellular location : Secreted

Protein Families : Type-B carboxylesterase/lipase family

Tissue Specificity : Thyroid gland specific.

Paythway :

Uniprot ID : P06882