Product Description
Recombinant Rat Thyroglobulin (Tg), partial is available at Gentaur for Next week Delivery.
Gene Name: Tg
Alternative Names : Tg
Expression Region : 21-300aa
AA Sequence : NIFEYQVDAQPLRPCELQREKAFLKQDEYVPQCSEDGSFQTVQCQNDGQSCWCVDSDGTEVPGSRQLGRPTACLSFCQLHKQRILLSSYINSTDALYLPQCQDSGNYAPVQCDLQQVQCWCVDTEGMEVYGTRQQGRPTRCPRSCEIRSRRLLHGVGDKSPPQCDADGEFMPVQCKFVNTTDMMIFDLIHNYNRFPDAFVTFSAFRNRFPEVSGYCYCADSQGRELAETGLELLLDEIYDTIFAGLDQASTFTQSTMYRILQRRFLAIQLVISGRFRCPT
Sequence Info : Partial
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 48 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Precursor of the iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3).
Function : Precursor of the iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3).
Involvement in disease : Defects in Tg are a cause of a form of hypothyroidism in rdw rat.
Subcellular location : Secreted
Protein Families : Type-B carboxylesterase/lipase family
Tissue Specificity : Thyroid gland specific.
Paythway :
Uniprot ID : P06882
Euro
British Pound
US Dollar