Recombinant Rat Trypsin-4 (Try4)

Product Description

Recombinant Rat Trypsin-4 (Try4) is available at Gentaur for Next week Delivery.

Gene Name: Try4

Alternative Names : Pretrypsinogen IV Trypsin IV

Expression Region : 24-247aa

AA Sequence : IVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHCYKRKLQVRLGEHNIHVLEGGEQFIDAEKIIRHPEYNKDTLDNDIMLIKLKSPAVLNSQVSTVSLPRSCASTDAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQITSNMFCLGFLEGGKDSCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWIQETMANN

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-sumostar-tagged

Theoretical MW : 40.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.

Function :

Involvement in disease :

Subcellular location : Secreted, extracellular space

Protein Families : Peptidase S1 family

Tissue Specificity :

Paythway :

Uniprot ID : P12788