Product Description
Recombinant Rat Urokinase plasminogen activator surface receptor (Plaur) is available at Gentaur for Next week Delivery.
Gene Name: Plaur
Alternative Names :
Expression Region : 25-299aa
AA Sequence : LRCIQCESNQDCLVEECALGQDLCRTTVLREWEDAEELEVVTRGCAHKEKTNRTMSYRMGSVIVSLTETVCATNLCNRPRPGARGRPFPRGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSVKDEPYTKGCGSLPGCPGTAGFHSNQTFHFLKCCNFTQCNGGPVLDLQSLPPNGFQCYSCEGNSTFGCSYEETSLIDCRGPMNQCLEATGLDVLGNRSYTVRGCATASWCQGSHVADSFQTHVNLSISCCNGSGCNRPTG
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 32.1kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Specifically cleaves the zymogen plasminogen to form the active enzyme plasmin.
Function : Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA.
Involvement in disease :
Subcellular location : Isoform 1: Cell membrane, Lipid-anchor, GPI-anchor, SUBCELLULAR LOCATION: Isoform 2: Secreted
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : P49616
Euro
British Pound
US Dollar