Recombinant Rat Vasopressin V1a receptor (Avpr1a), partial

Product Description

Recombinant Rat Vasopressin V1a receptor (Avpr1a), partial is available at Gentaur for Next week Delivery.

Gene Name: Avpr1a

Alternative Names : AVPR V1aAntidiuretic hormone receptor 1aVascular/hepatic-type arginine vasopressin receptor

Expression Region : 7-52aa

AA Sequence : SQDRSVGNSSPWWPLTTEGSNGSQEAARLGEGDSPLGDVRNEELAK

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 31.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger syst. Involved in social mory formation.

Function : Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system. Involved in social memory formation.

Involvement in disease :

Subcellular location : Cell membrane, Multi-pass membrane protein, Cytoplasmic vesicle membrane, Multi-pass membrane protein

Protein Families : G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily

Tissue Specificity : Localized within gonadotropes of the anterior pituitary of the brain. Broadly distributed throughout the cerebral cortex.

Paythway :

Uniprot ID : P30560