Recombinant Rat Vasopressin V1b receptor (Avpr1b), partial

Product Description

Recombinant Rat Vasopressin V1b receptor (Avpr1b), partial is available at Gentaur for Next week Delivery.

Gene Name: Avpr1b

Alternative Names : AVPR V1bAVPR V3Antidiuretic hormone receptor 1bVasopressin V3 receptor

Expression Region : 343-425aa

AA Sequence : NSRLLPRSLSHHACCTGSKPQVHRQLSTSSLTSRRTTLLTHACGSPTLRLSLNLSLRAKPRPAGSLKDLEQVDGEATMETSIF

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 13 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger syst.

Function : Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system.

Involvement in disease :

Subcellular location : Cell membrane, Multi-pass membrane protein

Protein Families : G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily

Tissue Specificity :

Paythway :

Uniprot ID : P48974